PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G187500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 534aa    MW: 58873.7 Da    PI: 5.4557
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G187500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.2e-183481148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT  Ed++lvd+vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Glyma.13G187500.1.p 34 KGPWTSTEDDILVDYVKKHGEGNWNAVQKHTGLFRCGKSCRLRWANHL 81
                         79******************************************9986 PP

2Myb_DNA-binding45.71.5e-1487130146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +g++ +eE+ l++++++++G++ W++ a++++ gRt++++k++w++
  Glyma.13G187500.1.p  87 KGAFAAEEERLIAELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 130
                          68899*****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0252981IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-223284IPR009057Homeodomain-like
SMARTSM007175.8E-153383IPR001005SANT/Myb domain
SuperFamilySSF466893.71E-2933128IPR009057Homeodomain-like
PfamPF002497.8E-163481IPR001005SANT/Myb domain
CDDcd001671.19E-113681No hitNo description
PROSITE profilePS5129423.78282136IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2385135IPR009057Homeodomain-like
SMARTSM007171.4E-1486134IPR001005SANT/Myb domain
PfamPF002491.3E-1387130IPR001005SANT/Myb domain
CDDcd001672.22E-1092130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MKKDIEDEVL PNDMSGAQLN DESYEGSAGI VLKKGPWTST EDDILVDYVK KHGEGNWNAV  60
QKHTGLFRCG KSCRLRWANH LRPNLKKGAF AAEEERLIAE LHAKMGNKWA RMAAHLPGRT  120
DNEIKNYWNT RIKRRQRAGL PLYPPEVSLH ALQESQHSQS TGGLNGGDKM HPDFLQKNSY  180
EIHDAIFDSL KDNQGILPYV HELSDISVYG NKLKGLDSSQ YCSFVPPTSP KRKRLKESTI  240
PFIDSCAMKK KDLYPFDQIQ DNNSDKIAQS FGMQAPLDPG LSSHSSMCYS HSLSNGNSST  300
SKPYEAMKLE LPSLQYPELD LGSWGSSPPP SLLESVDDFL QSPTAISTLE SDCSSPQNSG  360
LLDALLYQAK TMSSSKNHCS DKSSNSSTAT PGDRADSSIL NVYETEWEDY ADPVSPFGAT  420
SILNECPALR ANANSLNGQL PVQTFTGNLP KLESVDQVWT PNNENLTLSL LNITRPDFLL  480
ASDWYDLGSG HCKNQTITTD AATAFLGDDL ATDLKHMTAG ISKTMFENPF QPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31321355107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.241610.0cotyledon
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5258970.0KC525897.1 Glycine max GAMBY1-like family protein (GAMYB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006594349.20.0PREDICTED: transcription factor GAMYB-like
RefseqXP_006594350.20.0PREDICTED: transcription factor GAMYB-like
RefseqXP_006594351.20.0PREDICTED: transcription factor GAMYB-like
RefseqXP_006594352.20.0PREDICTED: transcription factor GAMYB-like
TrEMBLK7M0I70.0K7M0I7_SOYBN; Uncharacterized protein
STRINGGLYMA13G25716.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-110myb domain protein 33